PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019647-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 338aa    MW: 38263.6 Da    PI: 5.413
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019647-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.2e-1956103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT eEd++l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
    NNU_019647-RA  56 RGPWTVEEDLILINYIANHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 103
                      89********************************************97 PP

2Myb_DNA-binding50.45.1e-16109152146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    NNU_019647-RA 109 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 152
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.66551107IPR017930Myb domain
SuperFamilySSF466893.74E-3153150IPR009057Homeodomain-like
SMARTSM007178.8E-1655105IPR001005SANT/Myb domain
PfamPF002494.8E-1756103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2357110IPR009057Homeodomain-like
CDDcd001671.68E-1258103No hitNo description
SMARTSM007172.9E-14108156IPR001005SANT/Myb domain
PROSITE profilePS5129418.378108158IPR017930Myb domain
PfamPF002498.6E-15109152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-22111157IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
ILRSLLLSIG YRTDTRFPLV FSLSINELFL HFEGMDVNGR GCISGTSSEE EMDLRRGPWT  60
VEEDLILINY IANHGEGRWN SLARCAGLKR TGKSCRLRWL NYLRPDVRRG NITLEEQLLI  120
LELHSRWGNR WSKIAQYLPG RTDNEIKNYW RTRVQKHAKQ LQCDVNSKQF KDTMRYLWMP  180
RLVERIQAAA AASSTANTTT TTTTTTATVA YHPINGDNSD IMASQVPSAG SNNDVGIAQV  240
NTSFTPENSS TAGSSDSIGT QVSPVSDLAD YYTTLQPNSY VDNFQASQVN YQESLTSPTG  300
YFNQGLDFQA IDQNNMWLVD GDTSDNLWNI EDIWFMRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-26531561103MYB PROTO-ONCOGENE PROTEIN
1h8a_C8e-265315024120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276490.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE14e-98MY108_ARATH; Transcription factor MYB108
TrEMBLB9HIK11e-140B9HIK1_POPTR; GmMYB12 family protein
STRINGPOPTR_0008s10080.11e-140(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-96myb domain protein 108